DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31810 and C04F6.7

DIOPT Version :9

Sequence 1:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001379617.1 Gene:C04F6.7 / 13219936 WormBaseID:WBGene00195081 Length:447 Species:Caenorhabditis elegans


Alignment Length:163 Identity:31/163 - (19%)
Similarity:67/163 - (41%) Gaps:31/163 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 EEKLIAVTNEI----GSQYNVKIKWI---VADFAKG----REVYA-HIEKEL-----NGIEVGIL 137
            |.|::|:..|.    .|.:|..:|..   :..|..|    .|.:: ..:|||     :|:..|.|
 Worm     2 ESKVVALNRESRRWKKSSFNELLKVFQLRLLAFRHGNIREHEFFSKKFDKELLPIGRHGLTAGWL 66

  Fly   138 VNNVGTIHDPESLDKVSEDMLWDLLTVNVGSVTMLTRKILPQMISRRKGAIVNLGSSSELQPHPN 202
            :.::|.:.:.:::..:....|.     ..|.|:.:.|.::....::.|..||.:..::.::....
 Worm    67 IESLGQLLNSDNIRNIKCSQLG-----TDGFVSQIMRVVIEFTNNQTKKYIVKMPETTNIKAALE 126

  Fly   203 LTAY-----AATKKFV----THFTKGLEYEVAE 226
            .|..     .|.::|:    ..|.:.:||...|
 Worm   127 KTTQQKMPEGADEQFIGGLTMFFNREVEYYAME 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 31/163 (19%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 31/163 (19%)
C04F6.7NP_001379617.1 CHK 184..366 CDD:214734
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.