DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31810 and Hsd17b3

DIOPT Version :9

Sequence 1:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_446459.1 Gene:Hsd17b3 / 117182 RGDID:621805 Length:306 Species:Rattus norvegicus


Alignment Length:255 Identity:93/255 - (36%)
Similarity:144/255 - (56%) Gaps:12/255 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LPKTLAEKFGNWAVVTGATDGIGKEYARELARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWI 111
            ||.:.....|.|||:|||.|||||.|:.||||.|||:||:||..|||..::.||......::|.:
  Rat    35 LPGSFLRSMGQWAVITGAGDGIGKAYSFELARHGLNVVLISRTLEKLQVISEEIERTTGSRVKVV 99

  Fly   112 VADFAKGREVYAHIEKELNGIEVGILVNNVGTIHD--PESLDKVSEDMLWDLLTVNVGSVTMLTR 174
            .|||.: .::|.|||::|.|:|:|:||||||.:.:  |......|.:. ..::..|:.||..:|:
  Rat   100 QADFTR-EDIYDHIEEQLKGLEIGVLVNNVGMLPNLLPSHFLSTSGES-QSVIHCNITSVVKMTQ 162

  Fly   175 KILPQMISRRKGAIVNLGSSSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFV 239
            .:|..|.|||:|.|:|:.|...::|.|..:.|:|:|.||..|:|.|..|..:..|.:|::.|..|
  Rat   163 LVLKHMESRRRGLILNISSGVGVRPWPLYSLYSASKAFVCTFSKALNVEYRDKGIIIQVLTPYSV 227

  Fly   240 ATNMNSYSDKVRQGGLLFPNAYSYARSAV--FTLGKTSETNGFWVHGLQYAFMKLAPMDI 297
            :|.|..|.:..|    :...|..:.:.::  .|:|  :||.|...|.:....:.|.|..|
  Rat   228 STPMTKYLNTSR----VTKTADEFVKESLKYVTIG--AETCGCLAHEILAIILNLIPSRI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 93/255 (36%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 90/244 (37%)
Hsd17b3NP_446459.1 17beta-HSD1_like_SDR_c 44..281 CDD:187614 90/244 (37%)
adh_short 45..236 CDD:278532 79/192 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.