DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31810 and XB5863530

DIOPT Version :9

Sequence 1:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_002941866.3 Gene:XB5863530 / 100497556 XenbaseID:XB-GENE-5863531 Length:346 Species:Xenopus tropicalis


Alignment Length:300 Identity:111/300 - (37%)
Similarity:170/300 - (56%) Gaps:18/300 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALILQ--VISTGIYIVGSLSI--VAYLYENLKSLFSIIKSVVEPFFRPNLPKTLAEKFGNWAVV 61
            |..:|:  .:|.|..::|.:::  || :.:..:.|.......|..:::|||     .::|.||||
 Frog    25 MVSVLEEGCLSRGFALIGLITVGYVA-ITQGWRILCGFRAHFVSHWWKPNL-----RQYGTWAVV 83

  Fly    62 TGATDGIGKEYARELARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGREVYAHIE 126
            |||||||||.||.||||:|.::||:||..|||..|...|..:...|.|.|.||:.....:|..||
 Frog    84 TGATDGIGKSYAEELARRGFDIVLISRSPEKLQRVAEGIEQKSGRKTKIIQADYTGDVGIYTPIE 148

  Fly   127 KELNGIEVGILVNNVGTIHDPES---LDKVS-EDMLWDLLTVNVGSVTMLTRKILPQMISRRKGA 187
            :.|.|:::|:||||||..:..|.   ||..: ::.|.:::..|:.||..:||.:||.|:.::||.
 Frog   149 EGLKGLDIGVLVNNVGMAYSNEPVRFLDVPNVKERLTNVINCNIVSVLQMTRIVLPGMLKKKKGL 213

  Fly   188 IVNLGSSSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMNSYSDKVRQ 252
            |:|:.|.:...|.|.:..|::||.||.:|::.|..|.:...|.||.|||..|:||| ::..|   
 Frog   214 IINISSEAGSHPFPMVAVYSSTKVFVDYFSRCLHTEYSPQGITVQSVMPLLVSTNM-TFGIK--- 274

  Fly   253 GGLLFPNAYSYARSAVFTLGKTSETNGFWVHGLQYAFMKL 292
            ..:....:.||...|:.|:|.|:.|||...|.||..|..|
 Frog   275 SNIFVKTSDSYVYDALNTVGSTTRTNGCLSHALQSYFFHL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 106/286 (37%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 98/240 (41%)
XB5863530XP_002941866.3 17beta-HSD1_like_SDR_c 78..315 CDD:187614 98/240 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.