DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and AT1G63380

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001319302.1 Gene:AT1G63380 / 842644 AraportID:AT1G63380 Length:287 Species:Arabidopsis thaliana


Alignment Length:205 Identity:51/205 - (24%)
Similarity:99/205 - (48%) Gaps:22/205 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VVTGATDGIGKEYARELARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGREVYAH 116
            :||||:.|||:|...:|.:.|..:|..:|:.::|.::.:||.|...:.::.:..:.....|... 
plant    28 LVTGASSGIGREICLDLCKAGCKIVAAARRVDRLNSLCSEINSFGAIGVQAVALELDVSSEADT- 91

  Fly   117 IEKELNGI-----EVGILVNNVGTIHDPESLDKVSEDMLWD-LLTVNVGSVTMLTRKI-LPQMIS 174
            |.|.:...     ::.:|:||.|...:.:|...:||:. || :...|:....::::.: |....:
plant    92 IRKAVKEAWETFGKIDVLINNAGIRGNVKSSLDLSEEE-WDKVFRTNLTGSWLISKYVCLLMRDA 155

  Fly   175 RRKGAIVNLGSSSELQPHPNL----TAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNM 235
            .|.|:::|:.|.|.|  |..|    .|||.:|..|...|:.:..|:|.:.|.|..:.|..     
plant   156 ERGGSVINVSSISGL--HRGLLRGGLAYACSKGGVDTMTRMMAIELAVYKIRVNSIAPGI----- 213

  Fly   236 NSYSDKVRQG 245
              :..::.||
plant   214 --FRSEITQG 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 51/205 (25%)
DltE 50..302 CDD:223377 51/205 (25%)
AT1G63380NP_001319302.1 fabG 22..276 CDD:235546 51/205 (25%)
SDR_c 27..271 CDD:212491 51/205 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.