DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and Hsd17b12

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_114455.2 Gene:Hsd17b12 / 84013 RGDID:708367 Length:312 Species:Rattus norvegicus


Alignment Length:320 Identity:115/320 - (35%)
Similarity:186/320 - (58%) Gaps:25/320 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GLIYIVGSLSIAAFLYENLKSLFSIIKSVV------EPFFRPNLPKTLAEKFGNWAVVTGATDGI 60
            |.:|.||:.:||   |..|::.:|:.::..      :.|..|.|        |.||||||.||||
  Rat     9 GFLYWVGASTIA---YLTLRASYSLFRAFQVWCVGNQAFVGPRL--------GEWAVVTGGTDGI 62

  Fly    61 GKEYARELARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGREVYAHIEKELNGIE 125
            ||.||.|||::|:.:||:||.::||..|:|.|..::||:.:.|..||:.. ::|..|:..|:|:|
  Rat    63 GKSYAEELAKRGMKIVLISRSQDKLKEVSNNIKEKFNVETRTIAVDFSLD-DIYDKIKTGLSGLE 126

  Fly   126 VGILVNNVGTIHD-PESLDKVS--EDMLWDLLTVNVGSVTMLTRKILPQMISRRKGAIVNLGSSS 187
            :|:||||||..:: ||...::.  ::.:..|:.:||.|:..:||.:||.|:.|.||.|:|:.|:|
  Rat   127 IGVLVNNVGMSYEYPEYFLEIPDLDNTIKKLININVLSICKVTRLVLPGMVERSKGVILNISSAS 191

  Fly   188 ELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMNSYSDKVRQGGLLFPNA 252
            .:.|.|.||.|:|||.||..|::.|..|.....|.||.|:|.||||.:    .|:|:..|..|:|
  Rat   192 GMLPVPLLTVYSATKAFVDFFSQCLHEEYKSKGIFVQSVLPFFVATKL----AKIRKPTLDKPSA 252

  Fly   253 YSYARSAVFTLGKTSETNGFWVHGLQYALMKLFPMEIRTYFVYQLFKRMRIEAMEHRLKN 312
            .::.:||:.|:|..:.|.|:.:|.:..::..:.|..|....:....|.:|...::...||
  Rat   253 ETFVKSAIKTVGLQTRTTGYVIHAIMGSINSILPRWIYFKTIMGFNKSLRNRYLKKTKKN 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 97/240 (40%)
DltE 50..302 CDD:223377 99/254 (39%)
Hsd17b12NP_114455.2 17beta-HSD1_like_SDR_c 50..289 CDD:187614 98/243 (40%)
Di-lysine motif. /evidence=ECO:0000250 308..312 0/3 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100431
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.