DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and HSDL1

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_113651.4 Gene:HSDL1 / 83693 HGNCID:16475 Length:330 Species:Homo sapiens


Alignment Length:303 Identity:122/303 - (40%)
Similarity:185/303 - (61%) Gaps:5/303 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SLSIAAFLYENLKSLFSI--IKSVVEPFFRPNLPK--TLAEKFGNWAVVTGATDGIGKEYARELA 69
            :|::....|...||:..|  ..|::...|.|.|..  .|.:::|.||||:||||||||.||.|||
Human    24 ALALVGAWYTARKSITVICDFYSLIRLHFIPRLGSRADLIKQYGRWAVVSGATDGIGKAYAEELA 88

  Fly    70 RQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGREVYAHIEKELNGIEVGILVNNVG 134
            .:|||::|:||.||||..|..:|...|.|:...|||||:.|||:|..|.:.|...:|||||||||
Human    89 SRGLNIILISRNEEKLQVVAKDIADTYKVETDIIVADFSSGREIYLPIREALKDKDVGILVNNVG 153

  Fly   135 TIHD-PESLDKVSEDMLWDLLTVNVGSVTMLTRKILPQMISRRKGAIVNLGSSSELQPHPNLTAY 198
            ..:. |:...::|||.|||::.||:.:.:::...:||.|:.|:|||||.:.|.|..:|.|.|.|:
Human   154 VFYPYPQYFTQLSEDKLWDIINVNIAAASLMVHVVLPGMVERKKGAIVTISSGSCCKPTPQLAAF 218

  Fly   199 AATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMNSYSDKVRQGGLLFPNAYSYARSAVFTL 263
            :|:|.::.||::.|:||.|...|.||.::|.:|||:|.:.|:.:.:...|.|:...||..||.||
Human   219 SASKAYLDHFSRALQYEYASKGIFVQSLIPFYVATSMTAPSNFLHRCSWLVPSPKVYAHHAVSTL 283

  Fly   264 GKTSETNGFWVHGLQYALMKLFPMEIRTYFVYQLFKRMRIEAM 306
            |.:..|.|:|.|.:|:...:..|..:..:....|.:.:|.||:
Human   284 GISKRTTGYWSHSIQFLFAQYMPEWLWVWGANILNRSLRKEAL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 107/238 (45%)
DltE 50..302 CDD:223377 108/252 (43%)
HSDL1NP_113651.4 Required for mitochondria translocation 2..82 22/57 (39%)
17beta-HSD1_like_SDR_c 67..309 CDD:187614 108/241 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141585
Domainoid 1 1.000 189 1.000 Domainoid score I3291
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H100660
Inparanoid 1 1.050 230 1.000 Inparanoid score I3445
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 1 1.000 - - otm40861
orthoMCL 1 0.900 - - OOG6_100431
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3003
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.670

Return to query results.
Submit another query.