DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and AT5G18210

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_197322.2 Gene:AT5G18210 / 831939 AraportID:AT5G18210 Length:277 Species:Arabidopsis thaliana


Alignment Length:210 Identity:52/210 - (24%)
Similarity:84/210 - (40%) Gaps:36/210 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GNWAVVTGATDGIGKEYARELARQGLNLVL--VSRKEEKLIAVTNEIGSQYNVKIKWI------- 103
            |..|:|||::.|||:..|..||..|..:|:  .:|..|     .:::.::.|.....:       
plant    10 GRVAIVTGSSRGIGRAIAIHLAELGAKIVINYTTRSTE-----ADQVAAEINSSAGTVPQPIAVV 69

  Fly   104 -VADFAKGREV---YAHIEKELNGIEVGILVNNVGTIHDP---------ESLDKVSEDMLWDLLT 155
             :||.::..::   :...||..|. .|.||||:.|.::..         |..|::        ..
plant    70 FLADISEPSQIKSLFDAAEKAFNS-PVHILVNSAGILNPNYPTIANTPIEEFDRI--------FK 125

  Fly   156 VNVGSVTMLTRKILPQMISRRKGAIVNLGSSSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHN 220
            ||.....:..::...::.....|.|:.|.||......|...||.|:|..|....|.|..|:....
plant   126 VNTRGSFLCCKEAAKRLKRGGGGRIILLTSSLTEALIPGQGAYTASKAAVEAMVKILAKELKGLG 190

  Fly   221 IHVQLVMPAFVATNM 235
            |....|.|..|||.|
plant   191 ITANCVSPGPVATEM 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 52/210 (25%)
DltE 50..302 CDD:223377 51/208 (25%)
AT5G18210NP_197322.2 fabG 7..245 CDD:235500 52/210 (25%)
NADB_Rossmann 8..245 CDD:304358 52/210 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.