DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and AT3G55290

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_567019.1 Gene:AT3G55290 / 824695 AraportID:AT3G55290 Length:280 Species:Arabidopsis thaliana


Alignment Length:202 Identity:49/202 - (24%)
Similarity:100/202 - (49%) Gaps:17/202 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VVTGATDGIGKEYARELARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGREVYAH 116
            :||||:.|||:|...:||:.|..::..:|:.::|.::.:||.|..:..|:....:.....:. |.
plant    24 LVTGASSGIGREICLDLAKAGCQVIAAARRVDRLNSLCSEINSFSSTGIQAAALELDVSSDA-AT 87

  Fly   117 IEKELNGI-----EVGILVNNVGTIHDPESLDKVSEDMLWD-LLTVNVGSVTMLTRKILPQM-IS 174
            |:|.:...     ::..|:||.|...:.:|...:|||. || :...|:....::::.:...| .:
plant    88 IQKAVREAWDIFGKIDALINNAGIRGNVKSSLDLSEDE-WDNVFKTNLKGPWLVSKHVCMLMRDA 151

  Fly   175 RRKGAIVNLGSSSELQPH-PNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMNSY 238
            :|.|:::|:.|.:.::.. |...|||.:|..|...::.:..|:..|.|.|..:.|..       :
plant   152 KRGGSVINISSIAGIRGMLPGGLAYACSKGGVDTMSRMMALELGVHKIRVNSIAPGL-------F 209

  Fly   239 SDKVRQG 245
            ..::.||
plant   210 KSEITQG 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 49/202 (24%)
DltE 50..302 CDD:223377 49/202 (24%)
AT3G55290NP_567019.1 fabG 18..271 CDD:235546 49/202 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.