DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and AT3G04000

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_566221.2 Gene:AT3G04000 / 819555 AraportID:AT3G04000 Length:272 Species:Arabidopsis thaliana


Alignment Length:281 Identity:69/281 - (24%)
Similarity:110/281 - (39%) Gaps:58/281 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SVVEPFFRPNLPKTLAEKFGNWAVVTGATDGIGKEYARELARQGLNLVL-----VSRKEEKLIAV 88
            ||..|      |..||   |..|:|||::.|||:..|..||..|..:|:     ....|:...|:
plant     6 SVSSP------PLCLA---GRVAIVTGSSRGIGRAIAIHLAELGARVVVNYSTSPVEAEKVATAI 61

  Fly    89 TNEIGSQYNV-----KIKWIVADFAKGREVYAHIEKELNGIE--VGILVNNVGTIHDP--ESLDK 144
            |........|     ::..:.||.::..:|.:..::.....|  |.||||: ..|.||  .::..
plant    62 TTNCSKDAEVAGKSPRVIVVKADISEPSQVKSLFDEAERVFESPVHILVNS-AAIADPNHSTISD 125

  Fly   145 VSEDMLWDLLTVNVGSVTMLTRKILPQMISRRKGAIVNLGSSSELQPHPNLTAYAATKKFVTHFT 209
            :|.::...:::||.....:..|:...::.....|.|:.|.:|.....:.|..:|.|:|..|....
plant   126 MSVELFDRIISVNTRGAFICAREAANRLKRGGGGRIILLSTSLVQTLNTNYGSYTASKAAVEAMA 190

  Fly   210 KGLEYEVAEHNIHVQLVMPAFVATNM------NSYSDKVRQGGLLFPNAYSYARSAVFTLGKTSE 268
            |.|..|:....|.|..|.|..|||.|      |...:||:...|               .|:..|
plant   191 KILAKELKGTEITVNCVSPGPVATEMFYTGLSNEIVEKVKSQNL---------------FGRIGE 240

  Fly   269 TN-------------GFWVHG 276
            |.             |.|::|
plant   241 TKDIAPVVGFLASDAGEWING 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 63/262 (24%)
DltE 50..302 CDD:223377 62/260 (24%)
AT3G04000NP_566221.2 SDR 14..269 CDD:330230 65/267 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.