DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and AT3G03980

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_187048.1 Gene:AT3G03980 / 819553 AraportID:AT3G03980 Length:270 Species:Arabidopsis thaliana


Alignment Length:271 Identity:67/271 - (24%)
Similarity:103/271 - (38%) Gaps:49/271 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RPNLPKTLAEKFGNWAVVTGATDGIGKEYARELARQGLNLVL----------------------- 77
            :|.||  ||   |..|:|||::.|||:..|..||..|..:|:                       
plant     9 QPPLP--LA---GRVAIVTGSSRGIGRAIAIHLAELGARIVINYTSKAADAERVASEINDFPVRE 68

  Fly    78 -VSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGREVYAHIEKELNGIEVGILVNNVGTIHDPE- 140
             ::.|..:.|.|...:.....||..:..|:.|....|:             ||||:.| |.||: 
plant    69 EITGKGPRAIVVQANVSEPSQVKSMFDAAESAFEAPVH-------------ILVNSAG-ILDPKY 119

  Fly   141 -SLDKVSEDMLWDLLTVNVGSVTMLTRKILPQMISRRKGAIVNLGSSSELQPHPNLTAYAATKKF 204
             ::...|.:......:||.....:.:::...::.....|.|:.|.||......|...||||:|..
plant   120 PTIADTSVEDFDHTFSVNTKGAFLCSKEAANRLKQGGGGRIILLTSSQTRSLKPGFGAYAASKAA 184

  Fly   205 VTHFTKGLEYEVAEHNIHVQLVMPAFVATNM---NSYSDKVRQGGLLFP-NAYSYARSAVFTLGK 265
            |....|.|..|:....|....|.|..:||.|   ....:.|.:.....| .....|:..|..:|.
plant   185 VETMVKILAKELKGTGITANCVAPGPIATEMFFDGKTPELVEKIAAESPFGRVGEAKDVVPLVGF 249

  Fly   266 TSETNGFWVHG 276
            .:...|.||:|
plant   250 LAGDGGEWVNG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 62/259 (24%)
DltE 50..302 CDD:223377 61/257 (24%)
AT3G03980NP_187048.1 THN_reductase-like_SDR_c 14..270 CDD:187620 64/264 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.