DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and SDR5

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_566097.1 Gene:SDR5 / 819327 AraportID:AT2G47140 Length:257 Species:Arabidopsis thaliana


Alignment Length:230 Identity:52/230 - (22%)
Similarity:88/230 - (38%) Gaps:43/230 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GNWAVVTGATDGIGKEYARELARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGRE 112
            |...::||...|||.|..|.....|..:|:|.        |.:|:|....|.|       .:.:.
plant     8 GKIVIITGGASGIGAESVRLFTEHGARVVIVD--------VQDELGQNVAVSI-------GEDKA 57

  Fly   113 VYAHI----EKEL-NGI--------EVGILVNNVGTIHDPESLDKVSEDMLWDLLTVNVGSVTML 164
            .|.|.    |.|: |.:        ::.:|.:|.|.|....|:..::.:.|...:.:|:......
plant    58 SYYHCDVTNETEVENAVKFTVEKYGKLDVLFSNAGVIEPFVSILDLNLNELDRTIAINLRGTAAF 122

  Fly   165 TRKILPQMISRR-KGAIVNLGS-SSEL---QPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQ 224
            .:.....|:.:. :|:||...| ::|:   .||    .|..:|..:....|.....:.::.|.|.
plant   123 IKHAARAMVEKGIRGSIVCTTSVAAEIAGTAPH----GYTTSKHGLLGLIKSASGGLGKYGIRVN 183

  Fly   225 LVMPAFVATNMNSYSDKVRQGGLLFPNAYSYARSA 259
            .|.|..|||.:      |..|..:.||......||
plant   184 GVAPFGVATPL------VCNGFKMEPNVVEQNTSA 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 52/230 (23%)
DltE 50..302 CDD:223377 51/228 (22%)
SDR5NP_566097.1 PLN02253 1..255 CDD:177895 52/230 (23%)
NADB_Rossmann 5..253 CDD:304358 52/230 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.