DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and MOD1

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_565331.1 Gene:MOD1 / 815152 AraportID:AT2G05990 Length:390 Species:Arabidopsis thaliana


Alignment Length:246 Identity:54/246 - (21%)
Similarity:86/246 - (34%) Gaps:99/246 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GNWAVVTGATD--GIGKEYARELARQG-----------LNLVLVSRKEEK--------------- 84
            |..|.:.|..|  |.|...|:.||..|           ||:...|.:..|               
plant    94 GKRAFIAGIADDNGYGWAIAKSLAAAGAEILVGTWVPALNIFETSLRRGKFDQSRVLPDGSLMEI 158

  Fly    85 -----LIAV------------TNEIGSQYNVKIKWIVADFAKGREVYAHIEKELNGIEVGILVNN 132
                 |.||            ||:   :|.....|.|.:.|:      .::|:...|:  |||::
plant   159 KKVYALDAVFDNPEDVPEDVKTNK---RYAGSSNWTVQEAAE------CVKKDFGSID--ILVHS 212

  Fly   133 VGTIHDPESLDKVSEDMLWD-----LLTVNVGSVTM--LTRKILPQMISRRKGAIVNLGSSSELQ 190
            :.  :.||    ||:.:|..     |..::..|.:.  |.|..||         |:|.|.:|   
plant   213 LA--NGPE----VSKPLLETSRKGYLAAISASSYSFVSLLRHFLP---------IMNPGGAS--- 259

  Fly   191 PHPNLTAYAATKKFVTHF--------------TKGLEYEVA-EHNIHVQLV 226
              .:|| |.|:::.:..:              |:.|.||.. :.||.|..:
plant   260 --ISLT-YIASERIIPGYGGGMSSAKAALESDTRVLAYEAGRKSNIRVNTI 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 54/246 (22%)
DltE 50..302 CDD:223377 53/244 (22%)
MOD1NP_565331.1 PLN02730 86..388 CDD:178331 54/246 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.