DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and hsd17b12

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001017234.1 Gene:hsd17b12 / 549988 XenbaseID:XB-GENE-945229 Length:320 Species:Xenopus tropicalis


Alignment Length:235 Identity:101/235 - (42%)
Similarity:151/235 - (64%) Gaps:7/235 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KFGNWAVVTGATDGIGKEYARELARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKG 110
            :.|.|||||||||||||.||.|||::|:|:||:||..|||..|..:|..::.|:.|.|.|||.|.
 Frog    54 RIGKWAVVTGATDGIGKAYAEELAKRGMNIVLISRSPEKLEEVAKQIKEKFKVETKIIAADFGKP 118

  Fly   111 REVYAHIEKELNGIEVGILVNNVGTIHD-PESLDKVS--EDMLWDLLTVNVGSVTMLTRKILPQM 172
            .|:|..||..|..:|:|:||||||..:: ||...::.  |:.|..::.:|:.||..:||.:||.|
 Frog   119 TEIYGRIESGLRDLEIGVLVNNVGVSYEHPEYFLEIPDLENTLDKMININITSVCQMTRLVLPGM 183

  Fly   173 ISRRKGAIVNLGSSSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMNS 237
            :.|.:|.|:|:.|:|.:.|.|.||.|:|||.||..|::||:.|.....:.||.|:|.:|||.:  
 Frog   184 LGRGRGVILNISSASGMYPVPLLTVYSATKAFVDFFSRGLQAEYRSKGVTVQSVLPFYVATKL-- 246

  Fly   238 YSDKVRQGGLLFPNAYSYARSAVFTLGKTSETNGFWVHGL 277
              .|:|:.....|:..:|.:||:.|:|..::|||:..|.:
 Frog   247 --AKIRKPTWDKPSPETYVQSALNTVGLQTQTNGYLPHAI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 101/233 (43%)
DltE 50..302 CDD:223377 100/231 (43%)
hsd17b12NP_001017234.1 17beta-HSD1_like_SDR_c 56..297 CDD:187614 101/233 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.