DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and HSD17B12

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_057226.1 Gene:HSD17B12 / 51144 HGNCID:18646 Length:312 Species:Homo sapiens


Alignment Length:323 Identity:121/323 - (37%)
Similarity:181/323 - (56%) Gaps:31/323 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GLIYIVGSLSIAAFLYENLKSLFSIIKSVV-----EPFFRPNLPKTLAEKFGNWAVVTGATDGIG 61
            |.:|.||:.::|........|||:.::  |     |....|.|        |.||||||:|||||
Human     9 GFLYWVGAGTVAYLALRISYSLFTALR--VWGVGNEAGVGPGL--------GEWAVVTGSTDGIG 63

  Fly    62 KEYARELARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGREVYAHIEKELNGIEV 126
            |.||.|||:.|:.:||:||.::||..|::||..::.|:.:.|..||| ..::|..|:..|.|:|:
Human    64 KSYAEELAKHGMKVVLISRSKDKLDQVSSEIKEKFKVETRTIAVDFA-SEDIYDKIKTGLAGLEI 127

  Fly   127 GILVNNVGTIHD-PE------SLDKVSEDMLWDLLTVNVGSVTMLTRKILPQMISRRKGAIVNLG 184
            ||||||||..:: ||      .||.|.:.|    :.:|:.||..:|:.:||.|:.|.||||:|:.
Human   128 GILVNNVGMSYEYPEYFLDVPDLDNVIKKM----ININILSVCKMTQLVLPGMVERSKGAILNIS 188

  Fly   185 SSSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMNSYSDKVRQGGLLF 249
            |.|.:.|.|.||.|:|||.||..|::.|..|.....:.||.|:|.||||.:    .|:|:..|..
Human   189 SGSGMLPVPLLTIYSATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKL----AKIRKPTLDK 249

  Fly   250 PNAYSYARSAVFTLGKTSETNGFWVHGLQYALMKLFPMEIRTYFVYQLFKRMRIEAMEHRLKN 312
            |:..::.:||:.|:|..|.|||:.:|.|..:::...|..|....|..:.|..|...::...||
Human   250 PSPETFVKSAIKTVGLQSRTNGYLIHALMGSIISNLPSWIYLKIVMNMNKSTRAHYLKKTKKN 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 102/244 (42%)
DltE 50..302 CDD:223377 105/258 (41%)
HSD17B12NP_057226.1 NADB_Rossmann <3..>83 CDD:304358 34/83 (41%)
DltE 50..300 CDD:223377 105/258 (41%)
17beta-HSD1_like_SDR_c 50..289 CDD:187614 103/247 (42%)
Di-lysine motif 308..312 0/3 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.803099 Normalized mean entropy S1433
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100431
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.680

Return to query results.
Submit another query.