DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and hsdl1

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001008607.1 Gene:hsdl1 / 494064 ZFINID:ZDB-GENE-041212-31 Length:319 Species:Danio rerio


Alignment Length:284 Identity:87/284 - (30%)
Similarity:157/284 - (55%) Gaps:9/284 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IVGSLSIAAFLYENLKSLFSIIKSVVEPFFRPNL--PKTLAEKFGNWAVVTGATDGIGKEYAREL 68
            :||:..:|:.....::..:|:|:.    :|.|.|  .:.|::::|.||::.||::.|.|.||.||
Zfish    27 LVGACYMASKTVIFMRDCYSLIRL----YFVPRLVRHRDLSQQYGQWAIICGASEAIAKAYAEEL 87

  Fly    69 ARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGREVYAHIEKELNGIEVGILVNNV 133
            ||.|:.::|:|:....:......|.:.|.|:...|.|||.:|......|:..::..::|.:||:.
Zfish    88 ARHGICVILISKDLSSVSDTARLISNNYGVEAICIEADFNQGPSACKPIKDAISSKDIGFIVNSF 152

  Fly   134 -GTIHDPESLDKVSEDMLWDLLTVNVGSVTMLTRKILPQMISRRKGAIVNLGSSSELQPHPNLTA 197
             ||:...::..::||.:||..:..|:.:.|::||..||.|:.|.:||:||:.|.....|.|...|
Zfish   153 DGTLEISQNFLELSESVLWGTIDRNIAATTLVTRLALPAMMERGRGAVVNISSGHCFHPIPRKAA 217

  Fly   198 YAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMNSYSDKVRQGGLLFPNAYSYARSAVFT 262
            ::|:..|:.:|::.|:||..:..:.||.::|..||:.....|  ......|.|:...||..|:.|
Zfish   218 FSASTAFLDNFSRSLQYEYGDQGVFVQSLLPFRVASQRPEGS--APPASWLVPSPQVYASHALST 280

  Fly   263 LGKTSETNGFWVHGLQYALMKLFP 286
            ||.:..|.|:|.|.:|..|:|:.|
Zfish   281 LGISHRTTGYWPHSMQLGLVKMMP 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 77/238 (32%)
DltE 50..302 CDD:223377 77/238 (32%)
hsdl1NP_001008607.1 Required for mitochondria translocation. /evidence=ECO:0000250 2..82 15/58 (26%)
17beta-HSD1_like_SDR_c 67..307 CDD:187614 78/240 (33%)
adh_short 68..248 CDD:278532 57/179 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574572
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H100660
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2822
SonicParanoid 1 1.000 - - X3003
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.750

Return to query results.
Submit another query.