DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and zgc:101858

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001005597.1 Gene:zgc:101858 / 449555 ZFINID:ZDB-GENE-040927-13 Length:265 Species:Danio rerio


Alignment Length:238 Identity:63/238 - (26%)
Similarity:100/238 - (42%) Gaps:43/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VVTGATDGIGKEYARELARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKG------ 110
            ::|||:.|||...|...|:.|..|.|..|..|.|..|..|..:....|...:..|....      
Zfish    18 LITGASSGIGAGTALLFAKLGARLALNGRDVENLTKVAKECEACGAAKPLLVAGDLTDEETVRRT 82

  Fly   111 -REVYAHIEKELNGIEVGILVNNVGTI-------HDPESLDKVSEDMLWDLLTVNVGSVTMLTRK 167
             .||.||..:      :.:|||:.|.:       .|....|||        ::|||.|:..||..
Zfish    83 VEEVIAHFGR------LDVLVNSAGILAMGSIETTDMAQYDKV--------MSVNVRSIYHLTHL 133

  Fly   168 ILPQMISRRKGAIVNLGSSSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVA 232
            .:|.:| :.||:|||:.|.:..:..|.:.||..:|..:..||:.:..|:|...:.|..|.|..:.
Zfish   134 CVPHLI-KTKGSIVNVSSVNGQRSFPGVLAYCMSKSAIDQFTRCVALELASKQVRVNSVCPGVII 197

  Fly   233 TNMNSYSDKVRQGGLLFPNAYSYAR-----SAVFTLGKTSETN 270
            |.::      ::.||   :...||:     .....||:..|.:
Zfish   198 TEVH------KRAGL---DEEQYAQFIEKCKVTHALGRPGEVD 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 63/238 (26%)
DltE 50..302 CDD:223377 63/238 (26%)
zgc:101858NP_001005597.1 fabG 11..260 CDD:235546 63/238 (26%)
SDR_c11 12..262 CDD:187622 63/238 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.