DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and CG31546

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster


Alignment Length:232 Identity:70/232 - (30%)
Similarity:103/232 - (44%) Gaps:27/232 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GNWAVVTGATDGIGKEYARELARQGLNLVLVSRKEEKLIAVTN---EIGSQ-YNVKIKWIVADFA 108
            |...::|||..|||...|...::.|..|.||.|:||.||.|..   ::|.: |.     |..|..
  Fly    13 GKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPYG-----IAGDLL 72

  Fly   109 KGREVYAHIEKELNGIE--VGILVNNVGTIHDPESLDKVSEDMLWDLLTVNVGSVTMLTRKILPQ 171
            |..|:.....|.....|  :.:|||..| |....:|..........::..||.|...||:.:|||
  Fly    73 KPPEIECIARKTTERYEGKLDVLVNGAG-IMPTGTLQSTELACFTHVMEANVRSGFYLTKLLLPQ 136

  Fly   172 MISRRKGAIVNLGSSSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMN 236
            :: :.||:|||:.|...|:..|||.||..:|..|..||:.|..::....:.|..|.|..:.||:.
  Fly   137 LL-QCKGSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGVIRTNLQ 200

  Fly   237 SYSDKVRQGGLLFPNAYSYAR-----SAVFTLGKTSE 268
                  :.||:   :..|||.     .....||:..|
  Fly   201 ------KAGGM---DEQSYAEFLEHSKKTHALGRIGE 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 70/232 (30%)
DltE 50..302 CDD:223377 69/230 (30%)
CG31546NP_730973.1 fabG 9..257 CDD:235975 70/232 (30%)
NADB_Rossmann 11..261 CDD:304358 70/232 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.