DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and CG12171

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster


Alignment Length:207 Identity:64/207 - (30%)
Similarity:100/207 - (48%) Gaps:29/207 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VVTGATDGIGKEYARELARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGREVYAH 116
            :||||:.|||...:..||:.|..|.:|.|..:||    ||...|.      :.|..|...:|.|.
  Fly    10 IVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKL----NETAEQI------VAAGGAPALQVAAD 64

  Fly   117 I--EKELNGI---------EVGILVNNVGTIHDPESLDKVSEDMLWDLLTVNVGSVTMLTRKILP 170
            |  |.::.||         .:.:||||.| |.:..|::..|.:....::..||.|:..||..:.|
  Fly    65 INSESDVQGIVSATLAKHGRIDVLVNNAG-ILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTP 128

  Fly   171 QMISRRKGAIVNLGSSSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNM 235
            ::| :.||.|||:.|.:.::..|.:.||..:|..|..||:.:..|:|...:.|..|.|..:.|.:
  Fly   129 ELI-KTKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITEL 192

  Fly   236 NSYSDKVRQGGL 247
            .      |:|||
  Fly   193 Q------RRGGL 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 64/207 (31%)
DltE 50..302 CDD:223377 64/207 (31%)
CG12171NP_649563.1 fabG 2..251 CDD:235975 64/207 (31%)
NADB_Rossmann 4..254 CDD:304358 64/207 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.