DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and CG31549

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster


Alignment Length:208 Identity:66/208 - (31%)
Similarity:104/208 - (50%) Gaps:14/208 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VVTGATDGIGKEYARELARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGREVYAH 116
            :||||:.|||...|..||:.|..||:|.|.||||....:.|.:........:.||..|..||...
  Fly    10 IVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQADMTKEAEVQQI 74

  Fly   117 IEKEL--NGIEVGILVNNVGTIHDPESLDKVSEDMLWDLLTVNVGSVTMLTRKILPQMISRRKGA 179
            :...|  :| .:.:||||.| |.:..|::..|.:....|:..||.|:..||....|::: :.||.
  Fly    75 VGATLAKHG-RIDVLVNNAG-ILETGSIEATSLEQFDRLMNTNVRSLYQLTMLATPELV-KTKGN 136

  Fly   180 IVNLGSSSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMNSYSDKVRQ 244
            |||:.|...|:..|.:.||..:|..|..||..:..|:|...:.|..|.|..:.|:::      ::
  Fly   137 IVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTDIH------KR 195

  Fly   245 GGLLFPNAYSYAR 257
            ||:   :..:||:
  Fly   196 GGM---DEETYAK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 66/208 (32%)
DltE 50..302 CDD:223377 66/208 (32%)
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 66/208 (32%)
fabG 4..251 CDD:235975 66/208 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.