DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and hsd20b2

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001373557.1 Gene:hsd20b2 / 368367 ZFINID:ZDB-GENE-030804-21 Length:329 Species:Danio rerio


Alignment Length:297 Identity:122/297 - (41%)
Similarity:170/297 - (57%) Gaps:34/297 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VVEPFFRPNLPKTLAEKFGNWAVVTGATDGIGKEYARELARQGLNLVLVSRKEEKLIAVTNEIGS 94
            |:...:|.:|     ..:|.||||||||.|||:.||.|||::|||:||:||.||||..|..||..
Zfish    41 VISEIWRTDL-----RTYGRWAVVTGATSGIGRAYAEELAKRGLNIVLISRSEEKLHRVAKEIED 100

  Fly    95 QYNVKIKWIVADFAKGREVYAHIEKELNGIEVGILVNNVG-----------TIHDPESLDKVSED 148
            :||.|...|.|||.:|..:|:.|.|:|.|:|:||||||||           .:.||       :.
Zfish   101 KYNQKTHVIQADFTEGHSIYSTITKQLEGLEIGILVNNVGMNYIGVLANFLDVPDP-------DQ 158

  Fly   149 MLWDLLTVNVGSVTMLTRKILPQMISRRKGAIVNLGSSSELQPHPNLTAYAATKKFVTHFTKGLE 213
            .:..:|..|..|||.:.|.|||.|:.|.||.|:|:.|.:..||.|.::.|:|||.|||:|:.||.
Zfish   159 RITQVLNCNTLSVTQMCRVILPGMVERGKGLIINISSEAGYQPVPMVSLYSATKAFVTYFSLGLN 223

  Fly   214 YEVAEHNIHVQLVMPAFVATNMNSYSDKVRQGGLLFPNAYSYARSAVFTLGKTSETNGFWVHGLQ 278
            .|.....|.||.|.|..|:||| :::..|..   |..:|.|:||.|:.|:|.|:.|:|...|.||
Zfish   224 AEYRSKGITVQCVAPFMVSTNM-THNVPVNP---LVKSAASFARDALNTVGYTTYTSGCLTHALQ 284

  Fly   279 YALMKL-FPMEIR-TYFVYQLFKRMRIEAMEHRLKNQ 313
            :.::.: ||..:| |.|..|     |:|....|::.|
Zfish   285 HIVLSIVFPGWLRLTSFCVQ-----RMEKFARRIEPQ 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 109/249 (44%)
DltE 50..302 CDD:223377 114/264 (43%)
hsd20b2NP_001373557.1 17beta-HSD1_like_SDR_c 54..296 CDD:187614 111/252 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2822
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.