DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and CG8888

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster


Alignment Length:352 Identity:69/352 - (19%)
Similarity:116/352 - (32%) Gaps:94/352 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VGSLS-IAAFLYENLKSLFSIIKSVVEPFFRPNLPKTLAEKFGNWAVVTGATDGIGKEYAREL-- 68
            :.|:| .|.|::..|.::.:::      |:  :..|..|.  |...::||....:....|::|  
  Fly    63 ISSISTFAVFVWFALATVGAVL------FY--HFVKVSAS--GKGVLITGCEAPLAWYLAKKLDD 117

  Fly    69 ----ARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGREVYAHIE--KELNGIEVG 127
                ...|.|..:....|.|                  |:.:...||....|::  .|...:|..
  Fly   118 LGFTVYAGFNTPIEESDEAK------------------ILKEVTSGRMKLLHLDVTSEKTILEAA 164

  Fly   128 ILVNNVGTIHDPESLDKVSEDMLWDL-----------------------LTVNVGSVTMLTRKIL 169
            ..|:.    |.|...:.     ||.:                       |.:|:.....||:..|
  Fly   165 RYVSQ----HLPHGAEG-----LWSVVHCAHWIALGELEWIPFAVLRKSLDLNLLGSARLTQIFL 220

  Fly   170 PQMISRRKGAIVNLGSSSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVA-- 232
            | ::.|..|.:|.|.|.....|.|......||:..|..|...|..|:....:.|.:|.....|  
  Fly   221 P-LVRRAHGRVVFLTSGLNRVPSPVRGIQCATQAAVDCFAACLRQEMRTRGVDVSVVAAGEFAPG 284

  Fly   233 ---TNMNSYSDKVRQGGLLFPNAYS----------YARSAVFTLGKTSETNGFWVHGLQY---AL 281
               .|.....|:.:|    ..|..|          |..:|:.::.|.|.........|:.   |:
  Fly   285 NGWLNETELRDQAKQ----MWNQLSSEQKKTYGEDYYEAAMTSVEKYSRQAADIQPTLRVLIDAV 345

  Fly   282 MKLFPMEIRTYFVYQLFKRMRIEAMEH 308
            .:.|||  ..|......:|::|...||
  Fly   346 TRTFPM--ARYTPVTSSERLQIFLAEH 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 53/286 (19%)
DltE 50..302 CDD:223377 57/300 (19%)
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 60/309 (19%)
adh_short 96..293 CDD:278532 42/224 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447597
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.