DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and CG2064

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster


Alignment Length:299 Identity:66/299 - (22%)
Similarity:124/299 - (41%) Gaps:83/299 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EKFGNWAVVTGATDGIGKEYARELARQGLNLVL----VSRKEEKLIAVTNEIGSQYNVKIKWIVA 105
            ::.|...:||||..|||||.|.|:||:|..:.|    ::|.|:....:..|..:| |:       
  Fly    40 DETGKVFIVTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKDIIKETNNQ-NI------- 96

  Fly   106 DFAKGREVYA--HIEKELNGI-----EVGILVNNVGTIHDPESLDK-----------VSEDMLWD 152
             |::..::.:  .|.|.::|.     ::.:|:||.|.:..|::|.|           :...:|.:
  Fly    97 -FSRELDLSSLDSIRKFVDGFKKEQPKLHVLINNAGVMRCPKTLTKDGYELQLGVNHIGHFLLTN 160

  Fly   153 LLTVNVGSVTMLTRKILPQMISRRKGAIVNLGSSSELQPHPNLTAYAATKKFVTHFTKGLEYEVA 217
            || ::|...:..:|.::...::..:|:| |:...:..:.:....||:.:|.....||:.|...:.
  Fly   161 LL-LDVLKNSAPSRIVVVSSLAHARGSI-NVADLNSEKSYDEGLAYSQSKLANVLFTRELAKRLE 223

  Fly   218 EHNIHVQLVMPAFVATNMNSYSDKVRQGGLLFPNAYSYARSAVFTLGKTSETNGFWVHGLQYALM 282
            ...:.|..:.|..|.|.:                    ||:..|     .:||          |:
  Fly   224 GSGVTVNALHPGVVDTEL--------------------ARNWAF-----FQTN----------LV 253

  Fly   283 KLF--PMEIRTYFVYQLFKRMR-------IEAMEHRLKN 312
            |.|  ||      ::.|.|..:       ..|::..|||
  Fly   254 KFFLKPM------IWPLLKTPKSGAQTSIYAALDPELKN 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 58/261 (22%)
DltE 50..302 CDD:223377 61/275 (22%)
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 66/299 (22%)
NADB_Rossmann 43..317 CDD:304358 66/296 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447689
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.