DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and CG2070

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster


Alignment Length:245 Identity:61/245 - (24%)
Similarity:105/245 - (42%) Gaps:40/245 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 TLAEKFGNWAVVTGATDGIGKEYARELARQGLNLVLVSRKEEK-------LIAVTNE---IGSQY 96
            |...:.|..|:|||...|||||...||||:|..:.:..|..:|       :|..||.   ...|.
  Fly    37 TKTNETGRVAIVTGCNQGIGKETVLELARRGATVYMACRDMKKCENARREIIKATNNQNIFARQL 101

  Fly    97 NVKIKWIVADFAKGREVYAHIEKELNGIEVGILVNNVGTIHDPESLDKVSEDM----------LW 151
            ::.....:.:||.|      .::|.|  ::.||:||.|.:..|:.|.:...:|          |.
  Fly   102 DLCSMKSIRNFAAG------FKREQN--KLHILINNAGIMDCPKMLTEDGFEMQIGVNHMGHFLL 158

  Fly   152 DLLTVNVGSVTMLTRKILPQMISRRKGAIVNLGSSSELQPHPNLTAYAATKKFVTHFTKGLEYEV 216
            .||.::|...:..:|.::...|:.|.|.|.....:|| :.:....||..:|.....||:.|...:
  Fly   159 TLLLLDVLKSSAPSRVVVLSSIAHRFGRIKRDDLNSE-KSYDRKMAYCQSKLANVLFTRELAKRL 222

  Fly   217 AEHNIHVQLVMPAFVATN-------MNSYSDKVRQGGLLFPNAYSYARSA 259
            :...:.|..:.|..|.|.       :.|:..|:    |:.|..:.:.::|
  Fly   223 SGTGVTVNALHPGVVNTELFRNTPFLGSWFGKL----LIAPIIWIFIKTA 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 60/239 (25%)
DltE 50..302 CDD:223377 59/237 (25%)
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 60/241 (25%)
NADB_Rossmann 43..317 CDD:304358 60/239 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447690
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.