DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and CG30491

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001260784.1 Gene:CG30491 / 35704 FlyBaseID:FBgn0050491 Length:331 Species:Drosophila melanogaster


Alignment Length:278 Identity:67/278 - (24%)
Similarity:109/278 - (39%) Gaps:69/278 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SLFSIIKSVVE------------PFFRPNLPK-----TLAEKFGNWAVVTGATDGIGKEYARELA 69
            |||:.:||...            .||..:|.:     ....:.|...:||||..|||||..||:|
  Fly     2 SLFAFLKSRTAFWLSFTGTTTGLAFFVKDLMQGGQFTKETNETGKVFIVTGANTGIGKETVREIA 66

  Fly    70 RQGLNLVLVSR--------KEEKLIAVTN--------EIGSQYNVKIKWIVADFAKGREVYAHIE 118
            ::|..:.:..|        :||.::...|        ::.||.:  |:..||.|.:.:|   |:.
  Fly    67 KRGGTVYMACRNLKKCEEAREEIVLETKNKYVYCRQCDLASQES--IRHFVAAFKREQE---HLH 126

  Fly   119 KELNGIEVGILVNNVGTIHDPESLDKVSEDMLWDLLTVNVGSVTMLTRKILPQMISRRKGAIVNL 183
                     :|:||.|.:..|.||   :.|.:...|.||.....:||..:|..:.......|||:
  Fly   127 ---------VLINNAGVMRCPRSL---TSDGIELQLGVNHMGHFLLTNLLLDLLKKSSPSRIVNV 179

  Fly   184 GSSSELQPHPNL------------TAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMN 236
            .|.:..:...|.            .||:.:|.....||:.|...:...|:....:.|..|.|.: 
  Fly   180 SSLAHTRGEINTGDLNSDKSYDEGKAYSQSKLANVLFTRELAKRLEGTNVTANALHPGVVDTEI- 243

  Fly   237 SYSDKVRQGGLLFPNAYS 254
                 :|..| .|.|.::
  Fly   244 -----IRHMG-FFNNFFA 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 59/235 (25%)
DltE 50..302 CDD:223377 58/233 (25%)
CG30491NP_001260784.1 PRK06197 43..323 CDD:235737 59/237 (25%)
NADB_Rossmann 45..319 CDD:304358 59/235 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447687
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.