DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and firl

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001033900.2 Gene:firl / 34627 FlyBaseID:FBgn0032405 Length:318 Species:Drosophila melanogaster


Alignment Length:263 Identity:67/263 - (25%)
Similarity:108/263 - (41%) Gaps:46/263 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KSLFSIIKSVVEPFF---------------RPNLPKTLAEKFGNWAVVTGATDGIGKEYARELAR 70
            |.:|.::|.|:: ||               :..|||...:..|...::||...|||:|.|...|.
  Fly    14 KRIFDVLKDVLQ-FFELYVRILLELFVSLVQIVLPKKQKDVSGEIVLITGTGHGIGRELALHYAS 77

  Fly    71 QGLNLVLVS----------RKEEKLIAVTNEIGSQYNVKIKWIVADFAKGREVYAHIEKELNGIE 125
            .|..:|.|.          .|.::|     .:|..|:..     .|.:|..||.|..::..:.:.
  Fly    78 LGSTVVCVDIDGKNNLQTVEKAKRL-----NLGEVYSYS-----CDVSKRDEVTALADRIKSDVG 132

  Fly   126 -VGILVNNVGTIHDPESLDKVSEDMLWDLLTVNVGSVTMLTRKILPQMISRRKGAIVNLGSSSEL 189
             :.:||||||.:.....|.:.:|: :..:..|||.|.....:..||.|..:.:|.|:.:.|.:.|
  Fly   133 CISVLVNNVGIMPTHPILQQSAEE-IQRVFDVNVFSQFWTIQAFLPHMQEKCRGHIICMSSIAGL 196

  Fly   190 QPHPNLTAYAATKKFVTHFTKGLEYEVAE----HNIHVQLVMPAFVATNMNSYSDKVRQG---GL 247
            ....||..|.|||..|....:.|..|:.:    ..|....:.|....|.:..: .||:..   ||
  Fly   197 VGISNLVPYCATKFAVRGLMEALHAELRQGPFRDLIRTTTIFPYMTNTGLCKH-PKVKFPSILGL 260

  Fly   248 LFP 250
            |.|
  Fly   261 LDP 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 58/221 (26%)
DltE 50..302 CDD:223377 57/219 (26%)
firlNP_001033900.2 adh_short 56..246 CDD:278532 51/200 (26%)
17beta-HSDXI-like_SDR_c 57..299 CDD:187598 57/219 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447642
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.