DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and HSD17B3

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_000188.1 Gene:HSD17B3 / 3293 HGNCID:5212 Length:310 Species:Homo sapiens


Alignment Length:253 Identity:97/253 - (38%)
Similarity:143/253 - (56%) Gaps:14/253 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LPKTLAEKFGNWAVVTGATDGIGKEYARELARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWI 103
            |||:.....|.|||:|||.|||||.|:.|||::|||:||:||..|||.|:..||.......:|.|
Human    39 LPKSFLRSMGQWAVITGAGDGIGKAYSFELAKRGLNVVLISRTLEKLEAIATEIERTTGRSVKII 103

  Fly   104 VADFAKGREVYAHIEKELNGIEVGILVNNVGTIHDPESLDK---VSEDMLWDLLTVNVGSVTMLT 165
            .|||.|. ::|.||:::|.|:|:||||||||.:  |..|..   .:.|.:..|:..|:.||..:|
Human   104 QADFTKD-DIYEHIKEKLAGLEIGILVNNVGML--PNLLPSHFLNAPDEIQSLIHCNITSVVKMT 165

  Fly   166 RKILPQMISRRKGAIVNLGSSSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAF 230
            :.||..|.||:||.|:|:.|...|.|.|..:.|:|:|.||..|:|.|:.|.....:.:|::.|..
Human   166 QLILKHMESRQKGLILNISSGIALFPWPLYSMYSASKAFVCAFSKALQEEYKAKEVIIQVLTPYA 230

  Fly   231 VATNMNSYSDKVRQGGLLFPNAYSYARSAV--FTLGKTSETNGFWVHGLQYALMKLFP 286
            |:|.|..|.:.    .::...|..:.:.::  .|:|  .||.|...|.:....:.|.|
Human   231 VSTAMTKYLNT----NVITKTADEFVKESLNYVTIG--GETCGCLAHEILAGFLSLIP 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 93/242 (38%)
DltE 50..302 CDD:223377 93/242 (38%)
HSD17B3NP_000188.1 17beta-HSD1_like_SDR_c 48..284 CDD:187614 94/244 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.