DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and hsd17b12b

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_955907.1 Gene:hsd17b12b / 322626 ZFINID:ZDB-GENE-030131-1346 Length:311 Species:Danio rerio


Alignment Length:316 Identity:116/316 - (36%)
Similarity:184/316 - (58%) Gaps:19/316 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IYIVGSLSIAAFLYENLKSLFSIIKSV-VEPFFRPNLPKTLAEKFGNWAVVTGATDGIGKEYARE 67
            ::.||::::   |:.::.||:|:|..: |......||.:  |...|.|||||||||||||.||.|
Zfish     8 LFWVGAVTV---LWLSVSSLWSLINGIRVWILGNGNLMR--ASSLGKWAVVTGATDGIGKAYAEE 67

  Fly    68 LARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGREVYAHIEKELNGIEVGILVNN 132
            |||:|..:||:||.:|||..|:..|.|:|.|:.|.|.|||. ..::|..||..|.|:|:|:||||
Zfish    68 LARRGFAIVLISRTQEKLDEVSKAIESKYKVETKTISADFG-SVDIYPKIESGLAGLEIGVLVNN 131

  Fly   133 VGTIHD-PESLDKVS--EDMLWDLLTVNVGSVTMLTRKILPQMISRRKGAIVNLGSSSELQPHPN 194
            ||..:. ||....:.  :..:.:::.:|:.||..:||.:||:|:.|.||.|:|:.|:|.:.|.|.
Zfish   132 VGVSYSYPEFFLNIPDVDSFINNMININIMSVCQMTRLVLPRMVDRSKGVILNVASASGMYPVPL 196

  Fly   195 LTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMNSYSDKVRQGGLLFPNAYSYARSA 259
            ||.|::||.||..|::||:.|.....|.:|.|:|.:|.|.::    |:|:..|..|....|.::.
Zfish   197 LTLYSSTKAFVDFFSRGLDAEYKSKGIIIQSVLPFYVTTKLS----KIRKPTLDIPTPERYVKAQ 257

  Fly   260 VFTLGKTSETNGFWVHGLQ-YALMKLFPMEIRTYFVYQLFKRMRIEAMEHRLKNQK 314
            :.|:|..:::||:..|.:. :....|.|.::...:|    ..|.:......||.||
Zfish   258 LSTIGLQTQSNGYLPHAIMGWVTASLLPAKLLNKYV----MGMGLSQRARYLKKQK 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 98/241 (41%)
DltE 50..302 CDD:223377 99/255 (39%)
hsd17b12bNP_955907.1 PLN02780 8..307 CDD:166421 113/312 (36%)
17beta-HSD1_like_SDR_c 48..285 CDD:187614 98/241 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100431
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.