DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and CG3842

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster


Alignment Length:348 Identity:78/348 - (22%)
Similarity:132/348 - (37%) Gaps:94/348 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LIYIVGSLSIAAFLYENLKSLFSIIKSVVEPFFRPNLPKTLAEKF-GNWAVVTGATDGIGKEYAR 66
            ||::: .|.|..|::       .:.|.:..|.:|.      |.:. |...:|||...|||||...
  Fly    42 LIFLI-VLGILLFMW-------LLRKCIQGPAYRK------ANRIDGKVVIVTGCNTGIGKETVL 92

  Fly    67 ELARQGLNLVLVSR----------------KEEKLIAVTNEIGSQYNVKIKWIVADFAKGREVYA 115
            |||::|..:.:..|                :.::|...|.::||..:|:      :|.   |.:.
  Fly    93 ELAKRGARVYMACRDPGRCEAARLDIMDRSRNQQLFNRTLDLGSLQSVR------NFV---ERFK 148

  Fly   116 HIEKELNGIEVGILVNNVGTIHDPESLDKVSEDMLWDLLTVNVGSVTMLTRKILPQMISRRKGAI 180
            ..|..|:     ||:||.|.:..|.:|   :.|.......||.....:||..:|.::.......|
  Fly   149 AEESRLD-----ILINNAGVMACPRTL---TADGFEQQFGVNHLGHFLLTNLLLDRLKHSSPSRI 205

  Fly   181 VNLGSSS---------ELQPHPNLT----AYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVA 232
            |.:.|::         :|....|.:    ||:.:|.....||..|...:.:..:.|....|..|.
  Fly   206 VVVSSAAHLFGRINREDLMSEKNYSKFFGAYSQSKLANILFTLKLSTILKDTGVTVNCCHPGVVR 270

  Fly   233 TNMNSY-------SDKVRQGGLLF-----PNAYSYARSAVFTLGKTSETNGF-----------WV 274
            |.:|.:       ...:::|.|.|     ..|.:..|.|:....:.| |.|:           ||
  Fly   271 TEINRHFSGPGWMKTALQKGSLYFFKTPKAGAQTQLRLALDPQLEGS-TGGYYSDCMRWPLFPWV 334

  Fly   275 HGLQYA---------LMKLFPME 288
            ..:|.|         |:.|.|:|
  Fly   335 RNMQTADWLWRESEKLLGLPPLE 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 67/298 (22%)
DltE 50..302 CDD:223377 68/300 (23%)
CG3842NP_001259270.1 FabG 71..319 CDD:223959 59/265 (22%)
NADB_Rossmann 74..347 CDD:304358 65/290 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447691
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.