DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and CG3603

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster


Alignment Length:202 Identity:59/202 - (29%)
Similarity:93/202 - (46%) Gaps:9/202 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GNWAVVTGATDGIGKEYARELARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGRE 112
            |..|:||||..|||:...|.|||.|..::.|.|..:.......|:||:.:..::   .|.:..:.
  Fly     8 GKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSAALE---VDVSSAQS 69

  Fly   113 VYAHIEKELNGIEVG--ILVNNVGTIHDPESLDKVSEDMLWDLLTVNVGSVTMLTRKILPQMISR 175
            |...:.:.|...:..  |:||:.|...|...| |:.|....|:..||:....::|:.....||.:
  Fly    70 VQFSVAEALKKFQQAPTIVVNSAGITRDGYLL-KMPERDYDDVYGVNLKGTFLVTQAYAKAMIEQ 133

  Fly   176 R--KGAIVNLGSSSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMNS- 237
            :  .|.||||.|......:.....|||||..|..||:....|..:..|.|..::|.::.|.|.: 
  Fly   134 KLENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDTPMVAV 198

  Fly   238 YSDKVRQ 244
            ..|.|:|
  Fly   199 VPDSVKQ 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 59/202 (29%)
DltE 50..302 CDD:223377 58/200 (29%)
CG3603NP_001259199.1 fabG 6..248 CDD:235546 59/202 (29%)
BKR_SDR_c 9..248 CDD:187594 58/201 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447706
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.