DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and CG3699

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster


Alignment Length:249 Identity:73/249 - (29%)
Similarity:117/249 - (46%) Gaps:27/249 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VVTGATDGIGKEYARELARQGLNLVLVSRKEEKLIAVTNEI-GSQYNVKIKWIVADFAKGREVYA 115
            :||||:.|||...|:.|||:|..|.||.|....|.|....: |:|..:    :|||..|..:  |
  Fly     9 IVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLKGTQAEI----VVADVTKDAD--A 67

  Fly   116 HIEKELNGI-EVGILVNNVGTIH-------DPESLDKVSEDMLWDLLTVNVGSVTMLTRKILPQM 172
            .:::.|... .:.:||||.|.:.       |.|..|.|        |..|:..|.:||:.:||.:
  Fly    68 IVQQTLAKFGRIDVLVNNAGILGKGGLIDLDIEEFDAV--------LNTNLRGVILLTKAVLPHL 124

  Fly   173 ISRRKGAIVNLGSSSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMNS 237
            : :.|||:||:.|.:.::|.....:|..:|..:..|||.:..|:|...:.|..|.|.||.||::.
  Fly   125 L-KTKGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNIHR 188

  Fly   238 YSDKVRQ--GGLLFPNAYSYARSAVFTLGKTSETNGFWVHG-LQYALMKLFPME 288
            ....|.:  .|:|.....|:....|..:.:.:|...|.... ..:....|||::
  Fly   189 NIGIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPID 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 71/245 (29%)
DltE 50..302 CDD:223377 73/249 (29%)
CG3699NP_569875.2 fabG 1..244 CDD:235546 73/249 (29%)
NADB_Rossmann 3..248 CDD:304358 73/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.