DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and R05D8.9

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_503753.1 Gene:R05D8.9 / 187609 WormBaseID:WBGene00019886 Length:281 Species:Caenorhabditis elegans


Alignment Length:194 Identity:54/194 - (27%)
Similarity:95/194 - (48%) Gaps:10/194 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GNWAVVTGATDGIGKEYARELARQGLNLVLVSRKEEKLIAVTNEI--GSQYNVKIKWIVADFA-- 108
            |..|:|||:::|||:..|...|:.|..:.:..|..|:|.....||  .......:..:..|.|  
 Worm     7 GKVALVTGSSNGIGRAAAVLFAKDGAKVTVTGRNAERLEETRQEILKSGVPESHVLSVATDLAAE 71

  Fly   109 KGREVYAHIEKELNGIEVGILVNNVG-TIHDPESLDKVSEDM-LWD-LLTVNVGSVTMLTRKILP 170
            ||::...:...:..| .:.|||||.| ..:|.:....|.:|: ::| ::.:|:.||..||:|...
 Worm    72 KGQDELVNSTIQKFG-RLDILVNNAGAAFNDDQGRVGVDQDVSVYDKIMQINMRSVVTLTQKAKE 135

  Fly   171 QMISRRKGAIVNLGS-SSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVAT 233
            .:: :.||.|||:.| :......|.:..||.:|..:..||:....::.::.:.|..|.|..|.|
 Worm   136 HLV-KAKGEIVNVSSIAGTAHAQPGVMYYAMSKSALDQFTRCAAIDLIQYGVRVNSVSPGGVTT 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 54/194 (28%)
DltE 50..302 CDD:223377 53/192 (28%)
R05D8.9NP_503753.1 fabG 4..266 CDD:235975 54/194 (28%)
NADB_Rossmann 5..266 CDD:304358 54/194 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.