Sequence 1: | NP_001097168.1 | Gene: | CG31809 / 318954 | FlyBaseID: | FBgn0051809 | Length: | 316 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_506820.1 | Gene: | dhs-23 / 180038 | WormBaseID: | WBGene00000986 | Length: | 277 | Species: | Caenorhabditis elegans |
Alignment Length: | 212 | Identity: | 55/212 - (25%) |
---|---|---|---|
Similarity: | 94/212 - (44%) | Gaps: | 15/212 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 43 LAEKFGNWAVVTGATDGIGKEYARELARQGLNLVLVSRKEEKLIAVTNEI--GSQYNVKIKWIVA 105
Fly 106 DF--AKGREVYAHIEKELNGIEVGILVNNVGT-IHDPESLDKVSEDMLWDLLTVNVGSVTMLTRK 167
Fly 168 ILPQMISRRKGAIVNLGS-SSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFV 231
Fly 232 ATNM-------NSYSDK 241 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31809 | NP_001097168.1 | 17beta-HSD1_like_SDR_c | 48..286 | CDD:187614 | 54/207 (26%) |
DltE | 50..302 | CDD:223377 | 53/205 (26%) | ||
dhs-23 | NP_506820.1 | FabG | 3..259 | CDD:223959 | 54/210 (26%) |
SDR_c11 | 4..263 | CDD:187622 | 54/209 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D913128at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |