DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and Y47G6A.21

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001021764.1 Gene:Y47G6A.21 / 171924 WormBaseID:WBGene00021646 Length:255 Species:Caenorhabditis elegans


Alignment Length:243 Identity:73/243 - (30%)
Similarity:111/243 - (45%) Gaps:28/243 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 AVVTGATDGIGKEYARELARQGLNLVLVSR-----KEEKLIAVTNEIGSQYNVKIKWI--VADFA 108
            |::|||:.||||..|...|::...|.|..|     ||...:.::....|..::.|..:  .:|.|
 Worm     4 AIITGASSGIGKGTALLFAKKKYQLSLTGRNTDSLKEVAALCISEGAISADDILITAVELSSDEA 68

  Fly   109 KGREVYAHIEKELNGIEVGILVNNVGTIHDPESLDKVSEDMLWD-LLTVNVGSVTMLTRKILPQM 172
            ....|.|.::|  .| .:..|:|:.|.:.....||...|  ::| |:.|||.|:..|||..||.:
 Worm    69 PKAIVDATVQK--FG-RIDSLINSAGILRAGPVLDSGIE--VYDELMNVNVRSLIRLTRAALPHI 128

  Fly   173 ISRRKGAIVNLGSSSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMN- 236
            |: .||.:||:.|.:...|...:|.|..:|..|..|||.|..|:|.:.:.|..|.|..:.||:: 
 Worm   129 IT-TKGTVVNVSSINGPCPFAGVTYYCMSKSAVDQFTKCLALEMAPNGVRVNAVCPGVIVTNIHR 192

  Fly   237 -SYSDKVRQGGLL----------FPNAYSYARSAVFTLG--KTSETNG 271
             |..|:......|          .|...|....|:..|.  |:|.|.|
 Worm   193 ASGQDEATYAAFLEKSKTTHALGRPGTTSEVAEAILFLSSEKSSFTTG 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 73/243 (30%)
DltE 50..302 CDD:223377 73/243 (30%)
Y47G6A.21NP_001021764.1 FabG 1..249 CDD:223959 73/243 (30%)
NADB_Rossmann 3..252 CDD:304358 73/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.