DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and Hsd17b3

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_032317.2 Gene:Hsd17b3 / 15487 MGIID:107177 Length:305 Species:Mus musculus


Alignment Length:287 Identity:102/287 - (35%)
Similarity:156/287 - (54%) Gaps:17/287 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LSIAAFLYENLKSLFSIIKSVVEPFFR--PNLPKTLAEKFGNWAVVTGATDGIGKEYARELARQG 72
            |.|||.|:..|..|...::.....|.|  ..||.:.....|.|||:|||.|||||.|:.||||.|
Mouse     4 LFIAAGLFVGLVCLVKCMRFSQHLFLRFCKALPSSFLRSMGQWAVITGAGDGIGKAYSFELARHG 68

  Fly    73 LNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGREVYAHIEKELNGIEVGILVNNVGTIH 137
            ||:||:||..|||..:..||.......:|.:.|||.: .::|.||::.|.|:|:||||||||.:.
Mouse    69 LNVVLISRTLEKLQTIAEEIERTTGSCVKIVQADFTR-EDIYDHIKEHLEGLEIGILVNNVGMLP 132

  Fly   138 D--PESLDKVSEDMLWDLLTVNVGSVTMLTRKILPQMISRRKGAIVNLGSSSELQPHPNLTAYAA 200
            .  |......|.:. .:|:..|:.||..:|:.:|..|.|||||.|:|:.|.:.|:|.|..:.|:|
Mouse   133 SFFPSHFLSTSGES-QNLIHCNITSVVKMTQLVLKHMESRRKGLILNISSGAALRPWPLYSLYSA 196

  Fly   201 TKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMNSY-SDKVRQGGLLFPNAYSYARSAV--FT 262
            :|.||..|:|.|..|..:..|.:|::.|..::|.|..| ::|:.:      .|..:.:.::  .|
Mouse   197 SKAFVYTFSKALSVEYRDKGIIIQVLTPYSISTPMTKYLNNKMTK------TADEFVKESLKYVT 255

  Fly   263 LGKTSETNGFWVHGLQYALMKLFPMEI 289
            :|  :|:.|...|.:...::...|..|
Mouse   256 IG--AESCGCLAHEIIAIILNRIPSRI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 89/242 (37%)
DltE 50..302 CDD:223377 90/245 (37%)
Hsd17b3NP_032317.2 17beta-HSD1_like_SDR_c 44..280 CDD:187614 90/245 (37%)
adh_short 45..236 CDD:278532 81/192 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.