DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and Hsd17b3

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_446459.1 Gene:Hsd17b3 / 117182 RGDID:621805 Length:306 Species:Rattus norvegicus


Alignment Length:314 Identity:102/314 - (32%)
Similarity:165/314 - (52%) Gaps:30/314 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LIYIVGSLSIAAFLYENLKSLFSIIKSVVEPFFRPNLPKTLAEKFGNWAVVTGATDGIGKEYARE 67
            |:.:|..:..:.:|:      .|..|:         ||.:.....|.|||:|||.|||||.|:.|
  Rat    14 LVCLVKCVRFSRYLF------LSFCKA---------LPGSFLRSMGQWAVITGAGDGIGKAYSFE 63

  Fly    68 LARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGREVYAHIEKELNGIEVGILVNN 132
            |||.|||:||:||..|||..::.||......::|.:.|||.: .::|.|||::|.|:|:|:||||
  Rat    64 LARHGLNVVLISRTLEKLQVISEEIERTTGSRVKVVQADFTR-EDIYDHIEEQLKGLEIGVLVNN 127

  Fly   133 VGTIHD--PESLDKVSEDMLWDLLTVNVGSVTMLTRKILPQMISRRKGAIVNLGSSSELQPHPNL 195
            ||.:.:  |......|.:. ..::..|:.||..:|:.:|..|.|||:|.|:|:.|...::|.|..
  Rat   128 VGMLPNLLPSHFLSTSGES-QSVIHCNITSVVKMTQLVLKHMESRRRGLILNISSGVGVRPWPLY 191

  Fly   196 TAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMNSYSDKVRQGGLLFPNAYSYARSAV 260
            :.|:|:|.||..|:|.|..|..:..|.:|::.|..|:|.|..|.:..|    :...|..:.:.::
  Rat   192 SLYSASKAFVCTFSKALNVEYRDKGIIIQVLTPYSVSTPMTKYLNTSR----VTKTADEFVKESL 252

  Fly   261 --FTLGKTSETNGFWVHGLQYALMKLFPMEIRTYFVYQLFKRMRIEAMEHRLKN 312
              .|:|  :||.|...|.:...::.|.|..|   |.....:|..::.....||:
  Rat   253 KYVTIG--AETCGCLAHEILAIILNLIPSRI---FYSSTTQRFLLKQFSDYLKS 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 89/241 (37%)
DltE 50..302 CDD:223377 92/255 (36%)
Hsd17b3NP_446459.1 17beta-HSD1_like_SDR_c 44..281 CDD:187614 90/244 (37%)
adh_short 45..236 CDD:278532 79/192 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.