DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31809 and XB5863530

DIOPT Version :9

Sequence 1:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_002941866.3 Gene:XB5863530 / 100497556 XenbaseID:XB-GENE-5863531 Length:346 Species:Xenopus tropicalis


Alignment Length:289 Identity:110/289 - (38%)
Similarity:163/289 - (56%) Gaps:18/289 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLIYIVGSLSIAAFLYENLKSLFSIIKSVVEPFFRPNLPKTLAEKFGNWAVVTGATDGIGKEYA 65
            :||| .||.::|.    :..:.|.......|..:::|||     .::|.|||||||||||||.||
 Frog    41 IGLI-TVGYVAIT----QGWRILCGFRAHFVSHWWKPNL-----RQYGTWAVVTGATDGIGKSYA 95

  Fly    66 RELARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGREVYAHIEKELNGIEVGILV 130
            .||||:|.::||:||..|||..|...|..:...|.|.|.||:.....:|..||:.|.|:::|:||
 Frog    96 EELARRGFDIVLISRSPEKLQRVAEGIEQKSGRKTKIIQADYTGDVGIYTPIEEGLKGLDIGVLV 160

  Fly   131 NNVGTIHDPES---LDKVS-EDMLWDLLTVNVGSVTMLTRKILPQMISRRKGAIVNLGSSSELQP 191
            ||||..:..|.   ||..: ::.|.:::..|:.||..:||.:||.|:.::||.|:|:.|.:...|
 Frog   161 NNVGMAYSNEPVRFLDVPNVKERLTNVINCNIVSVLQMTRIVLPGMLKKKKGLIINISSEAGSHP 225

  Fly   192 HPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMNSYSDKVRQGGLLFPNAYSYA 256
            .|.:..|::||.||.:|::.|..|.:...|.||.|||..|:||| ::..|   ..:....:.||.
 Frog   226 FPMVAVYSSTKVFVDYFSRCLHTEYSPQGITVQSVMPLLVSTNM-TFGIK---SNIFVKTSDSYV 286

  Fly   257 RSAVFTLGKTSETNGFWVHGLQYALMKLF 285
            ..|:.|:|.|:.|||...|.||.....||
 Frog   287 YDALNTVGSTTRTNGCLSHALQSYFFHLF 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 99/242 (41%)
DltE 50..302 CDD:223377 98/240 (41%)
XB5863530XP_002941866.3 17beta-HSD1_like_SDR_c 78..315 CDD:187614 97/240 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2822
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.