DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31807 and elfless

DIOPT Version :10

Sequence 1:NP_723984.1 Gene:CG31807 / 318953 FlyBaseID:FBgn0051807 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_609860.2 Gene:elfless / 35076 FlyBaseID:FBgn0032660 Length:229 Species:Drosophila melanogaster


Alignment Length:119 Identity:25/119 - (21%)
Similarity:50/119 - (42%) Gaps:18/119 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 AERKKSEQKDKQLAKLNITTQEKDKMREEELKLYY-----QMEEEITNQKLLQEQLLFESKDELT 84
            ::.:.|...|.:.:..:|:........|....:.:     ..|:...|:::       :|.||  
  Fly   112 SDSESSSSSDSESSSTSISFDSSMSSTESSTPMGHTESSDSNEDSPPNKRI-------KSDDE-- 167

  Fly    85 QQLEKIAIENTCCICLDPWEAKDHHRLVSLRCGHLFGEMCIRTHLQHADMCPIC 138
             :.:|..:...|.:||:....|   ..||..|||:|.:.||:..:....:||:|
  Fly   168 -ESKKSVLPYNCPVCLEDVREK---LPVSTNCGHVFCKACIKRAVDTGRVCPLC 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31807NP_723984.1 mRING-C3HGC3_RFWD3 93..150 CDD:438114 15/46 (33%)
elflessNP_609860.2 RING_Ubox 176..>215 CDD:473075 12/41 (29%)

Return to query results.
Submit another query.