DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsph9 and rsph9

DIOPT Version :9

Sequence 1:NP_724049.1 Gene:Rsph9 / 318950 FlyBaseID:FBgn0051803 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001005021.1 Gene:rsph9 / 448532 XenbaseID:XB-GENE-5941075 Length:277 Species:Xenopus tropicalis


Alignment Length:287 Identity:95/287 - (33%)
Similarity:147/287 - (51%) Gaps:18/287 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNLEFFTEGLDCLMYCGMKLSPEQRILIENSLIALQNDNRFTGMYLWGRITATKNDYYIAFGYTN 65
            |:.|..:..|:.:...|..||.||...:..||..|..|.|...:.|||.:...:.||.||.|:..
 Frog     1 MDAETLSLSLELVSGSGPGLSAEQCAALRASLPLLHRDLRLRRLRLWGVVLGLRGDYVIARGWGG 65

  Fly    66 -DCLKDRKYFYSLDQFQWQLLPFVQSPKIFQAT-ILAREPFIGDPSLMTYVKLDPTFDIVGNQVA 128
             |.|:.:..||||:...|.|||......|.|.. |..|  |:|||:        ..::.:....|
 Frog    66 PDLLRGQLSFYSLNCVDWCLLPPATDAHIAQTQGIKGR--FVGDPA--------HEYEYIVRNTA 120

  Fly   129 G-----ISRPEVVKLKEEERLAAIVFIITEECAICPRGAFYKMTDGRVIPNQMFRGLNDLQIDNQ 188
            |     :.......:|||.||...:.:|..|.|:.||||:.:...|:||.|..||||...:....
 Frog   121 GGGDSALEEELTTHIKEEVRLTGTIAMIDREAAVAPRGAYIRNPLGQVIVNHSFRGLEVSEGKKL 185

  Fly   189 SYYQLYRLPRNDLKVNLAKRSDYNYAIDFLDTIDCVIPLCQAFALNMQRNEGLVIIKSCLWLGMT 253
            |.|..:....|..|.:|.:::..:.:|||||:::..||. .:::|.:::.:.::|::|.||||||
 Frog   186 SSYFHFTPSLNPKKKSLLEKAALDPSIDFLDSLEHDIPR-GSWSLQLEQGDSVLILRSLLWLGMT 249

  Fly   254 FFHKINSHKHGFLYLGDGKKNFDLLFM 280
            |:|...:..||.||:|.|::|.||.||
 Frog   250 FYHVPLTPLHGHLYIGTGERNLDLPFM 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsph9NP_724049.1 None
rsph9NP_001005021.1 Radial_spoke <82..275 CDD:368073 66/203 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 138 1.000 Domainoid score I4794
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H12606
Inparanoid 1 1.050 139 1.000 Inparanoid score I4405
OMA 1 1.010 - - QHG56448
OrthoDB 1 1.010 - - D406052at33208
OrthoFinder 1 1.000 - - FOG0008413
OrthoInspector 1 1.000 - - oto104717
Panther 1 1.100 - - LDO PTHR22069
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5258
SonicParanoid 1 1.000 - - X6405
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.