DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31802 and CDC31

DIOPT Version :9

Sequence 1:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_014900.3 Gene:CDC31 / 854431 SGDID:S000005783 Length:161 Species:Saccharomyces cerevisiae


Alignment Length:140 Identity:65/140 - (46%)
Similarity:96/140 - (68%) Gaps:0/140 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DLSLSQKVDIKKAFDLFDTQCTGFIETKELRVAIRALGFEPKKEDIKRMMDEIDKDKTGRIAFND 102
            :|...||.:|.:||.|||....||::..||:||::|||||..|.:|..::||.|.:....:.::|
Yeast    16 ELLEEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKREILDLIDEYDSEGRHLMKYDD 80

  Fly   103 FLYLMRLKMAEKDSNQDMMKAFSFFDDDRTGGISFLNLKRVAKELGEQLTDEELQEMIDEANVSG 167
            |..:|..|:.::|...::.:||..||||.||.||..||:||||||||.||||||:.||:|.::.|
Yeast    81 FYIVMGEKILKRDPLDEIKRAFQLFDDDHTGKISIKNLRRVAKELGETLTDEELRAMIEEFDLDG 145

  Fly   168 DGEVSKEEFL 177
            |||:::.||:
Yeast   146 DGEINENEFI 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 65/140 (46%)
EFh 46..108 CDD:238008 24/61 (39%)
EFh 119..181 CDD:238008 35/59 (59%)
CDC31NP_014900.3 PTZ00183 14..159 CDD:185503 65/140 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I2839
eggNOG 1 0.900 - - E2759_KOG0028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 150 1.000 Inparanoid score I1129
Isobase 1 0.950 - 0 Normalized mean entropy S400
OMA 1 1.010 - - QHG53747
OrthoFinder 1 1.000 - - FOG0000932
OrthoInspector 1 1.000 - - otm46605
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X601
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.