DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31802 and Cetn2

DIOPT Version :9

Sequence 1:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_215222.5 Gene:Cetn2 / 84593 RGDID:620247 Length:255 Species:Rattus norvegicus


Alignment Length:166 Identity:101/166 - (60%)
Similarity:132/166 - (79%) Gaps:5/166 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ASISSRAKKSKKPKLPTFDLSLSQKVDIKKAFDLFDTQCTGFIETKELRVAIRALGFEPKKEDIK 84
            ||.:.|.:.|.||     :|:..||.:|::||||||...||.|:.|||:||:||||||||||:||
  Rat    94 ASSAQRKRMSPKP-----ELTEEQKQEIREAFDLFDADGTGTIDMKELKVAMRALGFEPKKEEIK 153

  Fly    85 RMMDEIDKDKTGRIAFNDFLYLMRLKMAEKDSNQDMMKAFSFFDDDRTGGISFLNLKRVAKELGE 149
            :|:.||||:.||::.|:|||.:|..||:|||:.::::|||..||||.||.|||.|||||||||||
  Rat   154 KMISEIDKEGTGKMNFSDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGE 218

  Fly   150 QLTDEELQEMIDEANVSGDGEVSKEEFLNLIKKTNL 185
            .|||||||||||||:..|||||:::|||.::|||:|
  Rat   219 NLTDEELQEMIDEADRDGDGEVNEQEFLRIMKKTSL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 94/146 (64%)
EFh 46..108 CDD:238008 38/61 (62%)
EFh 119..181 CDD:238008 44/61 (72%)
Cetn2XP_215222.5 PTZ00183 99..255 CDD:185503 99/161 (61%)
EFh 115..177 CDD:238008 38/61 (62%)
EFh 188..250 CDD:238008 44/61 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7409
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 1 1.000 - - FOG0000932
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X601
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.030

Return to query results.
Submit another query.