DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31802 and AT1G73630

DIOPT Version :9

Sequence 1:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_177504.1 Gene:AT1G73630 / 843697 AraportID:AT1G73630 Length:163 Species:Arabidopsis thaliana


Alignment Length:164 Identity:46/164 - (28%)
Similarity:79/164 - (48%) Gaps:10/164 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SSRAKKSKKPKLPTFDLSLSQKVDIKKAFDLFDTQCTGFIETKELRVAIRALGFEPKKEDIKRMM 87
            ::..:.:.|...|:.|:      ::||.||.||....|.|...||....:::|....:|::.|::
plant     3 NTNLESTNKSTTPSTDM------ELKKVFDKFDANGDGKISVSELGNVFKSMGTSYTEEELNRVL 61

  Fly    88 DEIDKDKTGRIAFNDFLYLMRLKMAEKDSNQDMMKAFSFFDDDRTGGISFLNLKRVAKELGEQLT 152
            ||||.|..|.|...:|..:.|    ...|..::.:||..:|.::.|.||...:.:|...||...:
plant    62 DEIDIDCDGFINQEEFATICR----SSSSAVEIREAFDLYDQNKNGLISSSEIHKVLNRLGMTCS 122

  Fly   153 DEELQEMIDEANVSGDGEVSKEEFLNLIKKTNLI 186
            .|:...||...:..|||.|:.|||..::....|:
plant   123 VEDCVRMIGHVDTDGDGNVNFEEFQKMMSSPELV 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 43/146 (29%)
EFh 46..108 CDD:238008 21/61 (34%)
EFh 119..181 CDD:238008 19/61 (31%)
AT1G73630NP_177504.1 PTZ00184 20..152 CDD:185504 42/135 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.