DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31802 and CEN2

DIOPT Version :9

Sequence 1:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001031798.1 Gene:CEN2 / 829855 AraportID:AT4G37010 Length:171 Species:Arabidopsis thaliana


Alignment Length:169 Identity:69/169 - (40%)
Similarity:114/169 - (67%) Gaps:0/169 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 MHSSASISSRAKKSKKPKLPTFDLSLSQKVDIKKAFDLFDTQCTGFIETKELRVAIRALGFEPKK 80
            |.:..|.:::.::..|||..|:.|:..::.:|::.|||||...:|.|:..||.||:|:||||...
plant     1 MANYMSEAAQLRRGLKPKGKTYGLTNQKRREIREIFDLFDIDGSGSIDASELNVAMRSLGFEMNN 65

  Fly    81 EDIKRMMDEIDKDKTGRIAFNDFLYLMRLKMAEKDSNQDMMKAFSFFDDDRTGGISFLNLKRVAK 145
            :.|..:|.|:||:::|.|.|::|:::|..|..|:||..::.|||...|.|..|.||..::|.:||
plant    66 QQINELMAEVDKNQSGAIDFDEFVHMMTTKFGERDSIDELSKAFKIIDHDNNGKISPRDIKMIAK 130

  Fly   146 ELGEQLTDEELQEMIDEANVSGDGEVSKEEFLNLIKKTN 184
            ||||..||.:::|||:||:...||||:.|||:.::|:|:
plant   131 ELGENFTDNDIEEMIEEADRDKDGEVNLEEFMKMMKRTS 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 63/147 (43%)
EFh 46..108 CDD:238008 26/61 (43%)
EFh 119..181 CDD:238008 29/61 (48%)
CEN2NP_001031798.1 PTZ00183 15..169 CDD:185503 66/153 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 81 1.000 Domainoid score I2946
eggNOG 1 0.900 - - E2759_KOG0028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 172 1.000 Inparanoid score I1522
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 1 1.000 - - FOG0000932
OrthoInspector 1 1.000 - - mtm1107
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X601
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.940

Return to query results.
Submit another query.