DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31802 and AT4G26470

DIOPT Version :9

Sequence 1:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001328595.1 Gene:AT4G26470 / 828753 AraportID:AT4G26470 Length:294 Species:Arabidopsis thaliana


Alignment Length:191 Identity:45/191 - (23%)
Similarity:78/191 - (40%) Gaps:21/191 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RLGSMVSSASVMHSSASISSRAKKSKKPKLPTFDLSLSQKVDIKKAFDLFDTQCTGFIETKELRV 69
            :|.:.:..|....:|...:.::..|...|.|..|..|.   :.|..|..||....|.|:..||:.
plant    83 KLEAKIIEAVQRRASRGTTMKSFNSIVLKFPKIDDGLR---NCKAIFQEFDEDSNGSIDHTELKN 144

  Fly    70 AIRALGFEPKKEDIKRMMDEIDKDKTGRIAFNDFLYLMRLKMAEKDSNQDMMK------------ 122
            .||.|.....:|:|..:....|.::...|.|.:|:.|:.|....||.:..:.|            
plant   145 CIRKLEISFDEEEINDLFKACDINEDMGITFTEFIVLLCLVYLLKDDSSTLQKKWTMGMPKLEPT 209

  Fly   123 ------AFSFFDDDRTGGISFLNLKRVAKELGEQLTDEELQEMIDEANVSGDGEVSKEEFL 177
                  .|.|.|:::.|.:|...:.|...|.||:.:.....:..:|.:...:|.|:.:|||
plant   210 FETLVDTFVFLDENKDGYVSREEMVRAIDESGERSSGRIAMKRFEEMDWDKNGMVNFKEFL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 39/158 (25%)
EFh 46..108 CDD:238008 18/61 (30%)
EFh 119..181 CDD:238008 16/77 (21%)
AT4G26470NP_001328595.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.