DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31802 and cetn4

DIOPT Version :9

Sequence 1:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_002667227.2 Gene:cetn4 / 795310 ZFINID:ZDB-GENE-030826-21 Length:171 Species:Danio rerio


Alignment Length:168 Identity:104/168 - (61%)
Similarity:133/168 - (79%) Gaps:5/168 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SSASISSRAKKSKKPKLPTFDLSLSQKVDIKKAFDLFDTQCTGFIETKELRVAIRALGFEPKKED 82
            ||||.:.|.|...||     :|:..||.:||:|||||||..:|.|:.|||:||:||||||||||:
Zfish     8 SSASANQRKKAGPKP-----ELTEEQKQEIKEAFDLFDTDGSGTIDVKELKVAMRALGFEPKKEE 67

  Fly    83 IKRMMDEIDKDKTGRIAFNDFLYLMRLKMAEKDSNQDMMKAFSFFDDDRTGGISFLNLKRVAKEL 147
            ||:|:.:|||:.:|.|.|:|||.:|..||:||||.::::|||..||||.||.|||.|||||||||
Zfish    68 IKKMIADIDKEGSGVIGFSDFLSMMTQKMSEKDSKEEILKAFRLFDDDCTGKISFKNLKRVAKEL 132

  Fly   148 GEQLTDEELQEMIDEANVSGDGEVSKEEFLNLIKKTNL 185
            ||.|||||||||||||:..||||::::|||.::|||||
Zfish   133 GENLTDEELQEMIDEADRDGDGEINEQEFLRIMKKTNL 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 94/146 (64%)
EFh 46..108 CDD:238008 38/61 (62%)
EFh 119..181 CDD:238008 43/61 (70%)
cetn4XP_002667227.2 PTZ00183 15..171 CDD:185503 100/161 (62%)
EFh 31..93 CDD:238008 38/61 (62%)
EFh 104..166 CDD:238008 43/61 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7413
eggNOG 1 0.900 - - E2759_KOG0028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 1 1.000 - - FOG0000932
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X601
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.