DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31802 and Cetn4

DIOPT Version :9

Sequence 1:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001258080.1 Gene:Cetn4 / 688611 RGDID:1586489 Length:168 Species:Rattus norvegicus


Alignment Length:155 Identity:88/155 - (56%)
Similarity:123/155 - (79%) Gaps:0/155 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KPKLPTFDLSLSQKVDIKKAFDLFDTQCTGFIETKELRVAIRALGFEPKKEDIKRMMDEIDKDKT 95
            |.|....:|:.:||.:||:||||||...:|.|:.|||::|:||||||||||::|:::.||||:.|
  Rat    13 KKKAAKVELNDTQKQEIKEAFDLFDIDGSGTIDLKELKIAMRALGFEPKKEEVKQLITEIDKEGT 77

  Fly    96 GRIAFNDFLYLMRLKMAEKDSNQDMMKAFSFFDDDRTGGISFLNLKRVAKELGEQLTDEELQEMI 160
            |.|.|.||..:|.:||:|||..::::|||..||||.||.||..|:|||||||||.||::|||||:
  Rat    78 GTICFEDFFAIMSIKMSEKDEKEEILKAFKLFDDDATGSISLNNIKRVAKELGENLTEDELQEML 142

  Fly   161 DEANVSGDGEVSKEEFLNLIKKTNL 185
            |||:..||||:::||||.:::||:|
  Rat   143 DEADRDGDGEINEEEFLKMMRKTSL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 85/146 (58%)
EFh 46..108 CDD:238008 35/61 (57%)
EFh 119..181 CDD:238008 39/61 (64%)
Cetn4NP_001258080.1 PTZ00183 13..168 CDD:185503 88/155 (57%)
EFh 28..90 CDD:238008 35/61 (57%)
EFh 101..163 CDD:238008 39/61 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 1 1.000 - - FOG0000932
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X601
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.