DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31802 and cetn3

DIOPT Version :9

Sequence 1:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001018335.1 Gene:cetn3 / 552931 ZFINID:ZDB-GENE-050522-152 Length:167 Species:Danio rerio


Alignment Length:164 Identity:74/164 - (45%)
Similarity:116/164 - (70%) Gaps:6/164 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SISSR----AKKSKKPKLPTFDLSLSQKVDIKKAFDLFDTQCTGFIETKELRVAIRALGFEPKKE 81
            |:|.|    |.|||:.|  ..:|:..||.:||:||:||.|.....|:..||:||:||||||.||.
Zfish     2 SLSLRTELTADKSKRKK--RRELTDEQKDEIKEAFELFGTDKDKEIDYHELKVAMRALGFEVKKV 64

  Fly    82 DIKRMMDEIDKDKTGRIAFNDFLYLMRLKMAEKDSNQDMMKAFSFFDDDRTGGISFLNLKRVAKE 146
            |:.:::.:.|::.||:|:|.||..::...:.|:|..::::|||..||||.||.||..||:|||:|
Zfish    65 DVLKILKDYDREGTGKISFEDFREVVTDMILERDPKEEILKAFKLFDDDETGKISLRNLRRVARE 129

  Fly   147 LGEQLTDEELQEMIDEANVSGDGEVSKEEFLNLI 180
            |||.::||:|:.||||.:..||||::::||::::
Zfish   130 LGEDMSDEDLRAMIDEFDTDGDGEINQDEFISIM 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 66/143 (46%)
EFh 46..108 CDD:238008 28/61 (46%)
EFh 119..181 CDD:238008 33/62 (53%)
cetn3NP_001018335.1 PTZ00183 13..167 CDD:185503 70/153 (46%)
EFh 29..91 CDD:238008 28/61 (46%)
EFh 102..164 CDD:238008 33/62 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D512630at33208
OrthoFinder 1 1.000 - - FOG0000932
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X601
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.