DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31802 and cetn1

DIOPT Version :9

Sequence 1:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001017149.1 Gene:cetn1 / 549903 XenbaseID:XB-GENE-967617 Length:172 Species:Xenopus tropicalis


Alignment Length:170 Identity:103/170 - (60%)
Similarity:129/170 - (75%) Gaps:10/170 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 AKKSKKPKL----------PTFDLSLSQKVDIKKAFDLFDTQCTGFIETKELRVAIRALGFEPKK 80
            |...|||.|          |..:|:..||.:|::|||||||...|.|:.|||:||:|||||||||
 Frog     2 ASNYKKPSLGVTTQRKKPVPKPELTEEQKQEIREAFDLFDTDGAGTIDVKELKVAMRALGFEPKK 66

  Fly    81 EDIKRMMDEIDKDKTGRIAFNDFLYLMRLKMAEKDSNQDMMKAFSFFDDDRTGGISFLNLKRVAK 145
            |:||:|:.:|||:.||:|:|.||:..|..|||||||.:::||||..||||.||.|||.|||||||
 Frog    67 EEIKKMIADIDKEGTGKISFGDFMSAMTQKMAEKDSKEEIMKAFRLFDDDETGKISFKNLKRVAK 131

  Fly   146 ELGEQLTDEELQEMIDEANVSGDGEVSKEEFLNLIKKTNL 185
            ||||.|||||||||||||:..|||||:::|||.::|||:|
 Frog   132 ELGENLTDEELQEMIDEADRDGDGEVNEQEFLRIMKKTSL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 96/146 (66%)
EFh 46..108 CDD:238008 37/61 (61%)
EFh 119..181 CDD:238008 45/61 (74%)
cetn1NP_001017149.1 PTZ00183 16..172 CDD:185503 98/156 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 90 1.000 Domainoid score I7658
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 1 1.000 - - FOG0000932
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X601
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.030

Return to query results.
Submit another query.