DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31802 and cetn3

DIOPT Version :9

Sequence 1:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001016387.1 Gene:cetn3 / 549141 XenbaseID:XB-GENE-1001054 Length:167 Species:Xenopus tropicalis


Alignment Length:153 Identity:71/153 - (46%)
Similarity:110/153 - (71%) Gaps:2/153 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KSKKPKLPTFDLSLSQKVDIKKAFDLFDTQCTGFIETKELRVAIRALGFEPKKEDIKRMMDEIDK 92
            |:||.|  ..:|:..||.:||.||:||||.....|:..||:||:|||||:.||.|:.:::.:.|.
 Frog    13 KTKKKK--RRELTEEQKQEIKDAFELFDTDKDKAIDYHELKVAMRALGFDVKKADVLKILKDYDG 75

  Fly    93 DKTGRIAFNDFLYLMRLKMAEKDSNQDMMKAFSFFDDDRTGGISFLNLKRVAKELGEQLTDEELQ 157
            :.||:|.|:||..::...:.::|..::::|||..||||.:|.||..||:|||:||||.:|||||:
 Frog    76 ETTGKITFDDFNEVVTDLILDRDPQEEILKAFKLFDDDDSGKISLRNLRRVARELGENMTDEELR 140

  Fly   158 EMIDEANVSGDGEVSKEEFLNLI 180
            .||:|.:..||||:::||||:::
 Frog   141 AMIEEFDKDGDGEINQEEFLSIM 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 67/143 (47%)
EFh 46..108 CDD:238008 28/61 (46%)
EFh 119..181 CDD:238008 35/62 (56%)
cetn3NP_001016387.1 PTZ00183 15..166 CDD:185503 70/151 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D512630at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.