DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31802 and cetn3

DIOPT Version :10

Sequence 1:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001016387.1 Gene:cetn3 / 549141 XenbaseID:XB-GENE-1001054 Length:167 Species:Xenopus tropicalis


Alignment Length:153 Identity:71/153 - (46%)
Similarity:110/153 - (71%) Gaps:2/153 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KSKKPKLPTFDLSLSQKVDIKKAFDLFDTQCTGFIETKELRVAIRALGFEPKKEDIKRMMDEIDK 92
            |:||.|  ..:|:..||.:||.||:||||.....|:..||:||:|||||:.||.|:.:::.:.|.
 Frog    13 KTKKKK--RRELTEEQKQEIKDAFELFDTDKDKAIDYHELKVAMRALGFDVKKADVLKILKDYDG 75

  Fly    93 DKTGRIAFNDFLYLMRLKMAEKDSNQDMMKAFSFFDDDRTGGISFLNLKRVAKELGEQLTDEELQ 157
            :.||:|.|:||..::...:.::|..::::|||..||||.:|.||..||:|||:||||.:|||||:
 Frog    76 ETTGKITFDDFNEVVTDLILDRDPQEEILKAFKLFDDDDSGKISLRNLRRVARELGENMTDEELR 140

  Fly   158 EMIDEANVSGDGEVSKEEFLNLI 180
            .||:|.:..||||:::||||:::
 Frog   141 AMIEEFDKDGDGEINQEEFLSIM 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 67/143 (47%)
cetn3NP_001016387.1 PTZ00183 15..166 CDD:185503 70/151 (46%)

Return to query results.
Submit another query.