DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31802 and Eip63F-1

DIOPT Version :9

Sequence 1:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster


Alignment Length:199 Identity:55/199 - (27%)
Similarity:92/199 - (46%) Gaps:29/199 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGKRLGSMVSSASVMHSSASISSRAKKSKKPKLPTFDLSLSQKVDIKKAFDLFDTQCTGFIETK 65
            |||.|      ....|..:|.:..||.||.|.| |..::.:.   |::.||||.|....|.:...
  Fly     4 MSGLR------QQLKMLGTALLGKRATKSVKKK-PFTEVEIK---DLRTAFDLLDRNRDGRVTAN 58

  Fly    66 ELRVAIRALGFEPKKEDIKRMMDEIDKDKTGRIAFNDFL-YLMRLKMA---------EKDS---- 116
            ||:..::.||.....|.|..::.|......|.|...:|| ::.|::..         .|||    
  Fly    59 ELQFMLKNLGINVSDELIHDLIREASHSGNGLINEAEFLQWVGRIQALRDEQHSHEDSKDSKPVD 123

  Fly   117 -----NQDMMKAFSFFDDDRTGGISFLNLKRVAKELGEQLTDEELQEMIDEANVSGDGEVSKEEF 176
                 .:|::.||..||.|..|.|:...|:...:.:||.|.:::|::::..|::..||.::.|||
  Fly   124 EADDVTEDLIAAFRVFDRDGNGFITRDELQTAMEMIGEPLNEQQLEQLLVIADLDQDGRINYEEF 188

  Fly   177 LNLI 180
            ..|:
  Fly   189 TRLL 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 42/162 (26%)
EFh 46..108 CDD:238008 18/62 (29%)
EFh 119..181 CDD:238008 20/62 (32%)
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 42/163 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.