DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31802 and CG5024

DIOPT Version :9

Sequence 1:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster


Alignment Length:148 Identity:43/148 - (29%)
Similarity:80/148 - (54%) Gaps:0/148 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 TFDLSLSQKVDIKKAFDLFDTQCTGFIETKELRVAIRALGFEPKKEDIKRMMDEIDKDKTGRIAF 100
            |..|:..|..|.:.||.|||......|..|.||..:||:...|.:.:|:..:.|||.|.:|.:..
  Fly    18 THTLNDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYL 82

  Fly   101 NDFLYLMRLKMAEKDSNQDMMKAFSFFDDDRTGGISFLNLKRVAKELGEQLTDEELQEMIDEANV 165
            :||||:|..:........:::.||..||.|.:|.|.....:::..|.|:::.::|::|||.:|:.
  Fly    83 SDFLYIMSKRYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDADA 147

  Fly   166 SGDGEVSKEEFLNLIKKT 183
            :.:.::....|:.::.:|
  Fly   148 NTELKIDYVRFVTMMMET 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 42/146 (29%)
EFh 46..108 CDD:238008 23/61 (38%)
EFh 119..181 CDD:238008 15/61 (25%)
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 41/141 (29%)
EFh 28..90 CDD:298682 23/61 (38%)
EFh 64..127 CDD:238008 18/62 (29%)
EFh 101..163 CDD:298682 15/61 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443659
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.